지원사업
학술연구/단체지원/교육 등 연구자 활동을 지속하도록 DBpia가 지원하고 있어요.
커뮤니티
연구자들이 자신의 연구와 전문성을 널리 알리고, 새로운 협력의 기회를 만들 수 있는 네트워킹 공간이에요.
논문 기본 정보
- 자료유형
- 학술저널
- 저자정보
- 발행연도
- 1999.1
- 수록면
- 175 - 180 (6page)
이용수
초록· 키워드
오류제보하기
Sex pheromone biosynthesis is induced in many moths by a neuropeptide, PBAN, consisting of 33-amino acid amidated at the C-terminus. The present study is concerned with cloning and characterizing the partial sequence of Hea-PBAN cDNA whichis isolated from the brain and suboesophageal ganglion complex(Br-Sg) of Helicoverpa armigera adults. From the cDNA sequence, it can be predicted that the cDNA has a PBAN domain with 33 amino acids, LSDDM-PATPADQEMYRQDPEQIDSRTKYFSPRL, with FSPRL at the C-terminus. The amino acid sequence of predicted peptides including the PBAN, is identical to that of H.zea and H.assulta.
목차
등록된 정보가 없습니다.
참고문헌 (0)
참고문헌 신청함께 읽어보면 좋을 논문
논문 유사도에 따라 DBpia 가 추천하는 논문입니다. 함께 보면 좋을 연관 논문을 확인해보세요!
-
Regulation of Sex Pheromone Biosynthesis and Structure of PBAN cDNA in Adoxophyes sp. Collected from Pear Orchards in Korea
한국응용곤충학회 학술발표회
2001 .01
-
Mating Effect on Sex Pheromone Production of the Oriental tobacco budworm, Helicoverpa assulta
Journal of Asia-Pacific Entomology
2002 .01
-
Sex Pheromone Biosynthesis and Insect Neuropeptide: From Basic Researches to the Application
한국응용곤충학회 학술발표회
2002 .01
-
C75, a Fatty Acid Synthase Inhibitor, Inhibits Feeding Activity and Pheromone Production in a Moth, Helicoverpa zea
Journal of Asia-Pacific Entomology
2006 .01
-
Cloning and Functional Expression of Acyl-CoA Desaturase-encoding cDNAs Isolated from Pheromone Gland of Helicoverpa assulta, the Oriental Tobacco Budworm (Noctuidae, Lepidoptera)
한국동물학회 학술대회
2003 .01
-
Interaction of Bacillus thuringiensis $\delta$-endotoxins with Midgut Brush Border Membrane Vesicles of Helicoverpa armigera
Journal of Asia-Pacific Entomology
1999 .01
-
Molecular Characterization of Pheromone Biosynthesis Activating Neuropeptide from the Diamondback Moth, Plutella xylostella (L.)
한국응용곤충학회 학술발표회
2005 .01
-
Partial Sequence Analysis of Randomly Selected Watermelon [Citrullus lanantus (Thunb.) Mansf.] cDNA Clones
식물학회지
1997 .01
-
Genetic relatedness among Helicoverpa armigera ($H\"{u}bner$) occurring on different host plants as revealed by random amplified polymorphic DNA markers
Journal of Asia-Pacific Entomology
2006 .01
-
수원지방에서 왕담배나방 (밤나방과) 휴면 유기시기와 연간 발생 세대
한국응용곤충학회지
2015 .01
-
Morphometric Variation in Geographic Populations of Cotton Bollworm, Helicoverpa armigera ($H{\ddot{u}}bner$) Occurring in South Indian Cotton Ecosystems
Journal of Asia-Pacific Entomology
2007 .01
-
Neuropeptidomics: Mass Spectrometry-Based Identification and Quantitation of Neuropeptides
Genomics & informatics
2016 .01
-
Assessment of Pheromone Traps for Monitoring and Control of Helicoverpa assulta (Lepidoptera: Noctuidae) in Red Pepper Fields
한국응용곤충학회 학술발표회
2002 .01
-
Biological and Impact Assessment Studies on Campoletis chlorideae Uchida： A Promising Solitary Larval Endoparasitiod of Helicoverpa armigera (Hubner)
Journal of Asia-Pacific Entomology
2004 .01
-
Expression of Cold-Stress-inducible cDNA Clone Isolated from Potato (Solanum tuberosum L.) tuber cDNA Library
한국동물학회 학술대회
2000 .01
-
Cloning of the 5'-end and Amplification of Full-Length cDNA of Genomic RNA of Lily symptomless virus
The Plant Pathology Journal
2002 .08
이 논문의 저자 정보
최근 본 자료
댓글(0)
0